Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGQIPLEHGLIVATILFALGFYGVMVRRNLLFMLMSLEIMMNAAALAFVLAGSVWAQPDGQVMFILILTLAAAEACIGLAIVLQFYHRFHHLDVDAASEMRG 3WGV Chain:G ((31-48)) ---------LIFAALAFIVGLIIILSK---------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3WGV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 2 -519 -259.50 -28.83 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain G : 0.48 3D Compatibility (PKB) : -259.50 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.48 QMean score : 0.020

(partial model without unconserved sides chains): PDB file : Tito_3WGV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3WGV-query.scw PDB file : Tito_Scwrl_3WGV.pdb: