Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYKPYMISYDLNNPGQKYDKVFEIIKEFGAYIKLQKSFWLVK-TNLNPNQMCEKLNTVLDN-NDSLFICELQKNYQGRATEENWKFINEHIFS 1ZPW Chain:X ((2-71)) GKRLYAVAYDIPDD-TRRVKLANLLKSYGE--RVQLSVFECYLDERLLEDLRRRARRLLDLGQDALRIYPVAG--------------------

General information: TITO was launched using: RESULT: Template: 1ZPW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 243 -25022 -102.97 -367.96 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain X : 0.66 3D Compatibility (PKB) : -102.97 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.680

(partial model without unconserved sides chains): PDB file : Tito_1ZPW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ZPW-query.scw PDB file : Tito_Scwrl_1ZPW.pdb: