Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence EWCTVTVFYQGRTSGYPLPT---AKKVGIVQSFPGEGKGYADYQYILDENCDWKEHGRPWLTGMRLETVPFVAKQKYE 2JX5 Chain:A ((1-69)) --MLVIVRLQDQTLPFELPAGARASQLSNLLSSSGMAFSLHTQGRVLSEA-------AELNDKMVIDAFVPADGAGLE

General information: TITO was launched using: RESULT: Template: 2JX5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 239 -15381 -64.36 -233.05 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -64.36 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.238

(partial model without unconserved sides chains): PDB file : Tito_2JX5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JX5-query.scw PDB file : Tito_Scwrl_2JX5.pdb: