Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KSYKAQKICHFTILKMYKNTWTFVRKDSAPADQTTTIEGIKVFFSKDCIPQHDYRGLYIEYNGFHHDVSQS 1WHM Chain:A ((41-84)) -----------------LGYFVGVDMDNPIGNWDGRFDGVQLC---SFAC--VESTILLHINDIIP-----

General information: TITO was launched using: RESULT: Template: 1WHM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 127 -12855 -101.22 -292.16 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -101.22 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.342

(partial model without unconserved sides chains): PDB file : Tito_1WHM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1WHM-query.scw PDB file : Tito_Scwrl_1WHM.pdb: