Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------PSDGPEAPEELCFTTIIRRRDGFKYAEKGPIGQKIAFLAG---LNCTVQKGCKLACTPAHYGLKYKVSCRPA- 5A6W Chain:C ((11-93)) RAIDLSRERDPNFFDHPGIPVPECFWFMFKNN-VRQDAGTCYSSWKMDMKVGPNWVHIKSDDNCNLSGDFPP-GWIVLGKKRPGF

General information: TITO was launched using: RESULT: Template: 5A6W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 204 3479 17.05 51.92 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain C : 0.68 3D Compatibility (PKB) : 17.05 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.461

(partial model without unconserved sides chains): PDB file : Tito_5A6W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5A6W-query.scw PDB file : Tito_Scwrl_5A6W.pdb: