Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence PWNNYC-QLTLMRGRQIQAQSYLVR-RSFPLTTVVIRLEPGKSRSFKLNWNCRLKIPRGVVPEGHWLYADMKYMTPSMAADLNNLLDGAPWPLEWPLDRESLRLESQRNSRVFQS 5LOP Chain:C ((3-64)) NFKGYQIEIELKDGKRITGTLKQVSPKSLTLTDAVFQ-DGGVSPVFKIKADKLYDLKVLKLPP----------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5LOP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 231 1309 5.67 21.82 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain C : 0.62 3D Compatibility (PKB) : 5.67 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.365

(partial model without unconserved sides chains): PDB file : Tito_5LOP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5LOP-query.scw PDB file : Tito_Scwrl_5LOP.pdb: