Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGAISREDAENLLESQPLGSFLIRVSHSHVG-YTLSYKAQSSCCHFMVKLLDDGTFMIPGEKVAHTSLDALVTFH 5DC9 Chain:A ((18-93)) WYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNT-LAELVHHH

General information: TITO was launched using: RESULT: Template: 5DC9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 269 -27716 -103.03 -369.55 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.78 3D Compatibility (PKB) : -103.03 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.531

(partial model without unconserved sides chains): PDB file : Tito_5DC9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5DC9-query.scw PDB file : Tito_Scwrl_5DC9.pdb: