Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIMLLFILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKYYYSKSREKVYTIPDLLQR 3RH3 Chain:A ((84-135)) --------------------------------------------------NLKQNYAGLFNVRTQFYDNFNKF--LAYKKSKDTAKTAQLLDENYKLSVELSEY------------------

General information: TITO was launched using: RESULT: Template: 3RH3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 99 7553 76.29 145.25 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : 76.29 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.441

(partial model without unconserved sides chains): PDB file : Tito_3RH3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3RH3-query.scw PDB file : Tito_Scwrl_3RH3.pdb: