Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIMLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKL--VMNRGFISC 2GOM Chain:A ((105-165)) -IKKEQKLIQAQNLVREFEKTHTVSAHRKAQKAVNLVS-------------------FEYKVKKMVLQERIDNVLKQGLVR-

General information: TITO was launched using: RESULT: Template: 2GOM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 172 -12337 -71.72 -209.09 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -71.72 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.428

(partial model without unconserved sides chains): PDB file : Tito_2GOM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2GOM-query.scw PDB file : Tito_Scwrl_2GOM.pdb: