Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEQLHFITKLLDIKDPNVQILNIINKDTHKEIIAKLDYDAPSCPECGNQ-LKKYDFQKPSKIPYLETTGIPTRILLRKRRFKCYHCSKMMVAETSDDVQSYFFSFYYITVLNLALLDSPLLSIYSEKRRKT 4KYW Chain:A ((5-64)) --ELHFNLELVETYKSNSQKARILTED--------WVYRQSYCPNCGNNPLNHFENNRPVA------------------DFYCNHCSE-------------------------------------------

General information: TITO was launched using: RESULT: Template: 4KYW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 140 -4794 -34.24 -81.25 target 2D structure prediction score : 0.34 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -34.24 2D Compatibility (Sec. Struct. Predict.) : 0.34 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.217

(partial model without unconserved sides chains): PDB file : Tito_4KYW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4KYW-query.scw PDB file : Tito_Scwrl_4KYW.pdb: