Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRSGRDKKIAGVCAGVAHYLDMDPTIVRVIWGVLTCCYGAGIVAYIILWIIAPVATDY 1KA9 Chain:H ((74-85)) ----RGLPFLGICVGM------------------------------------------

General information: TITO was launched using: RESULT: Template: 1KA9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 4 -270 -67.38 -22.46 target 2D structure prediction score : 0.17 Monomeric hydrophicity matching model chain H : 0.41 3D Compatibility (PKB) : -67.38 2D Compatibility (Sec. Struct. Predict.) : 0.17 1D Compatibility (Hydrophobicity) : 0.41 QMean score : 0.500

(partial model without unconserved sides chains): PDB file : Tito_1KA9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1KA9-query.scw PDB file : Tito_Scwrl_1KA9.pdb: