Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------------------------------------------------------------------------------------------------------------------------------------------------MEFLLYTISKVKLLEDILMPQPIVPVEIPQSRPFDSKKRNDILLKIRIGKLEVSFFQ-SLNLEMVEQLLDKVLLYDNSSI---- 4F7O Chain:A ((2-257)) AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRT-----ISAGKVNLGAFRTYPKGYKPPDK-----QYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLT

General information: TITO was launched using: RESULT: Template: 4F7O.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 82 584 7.12 8.46 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : 7.12 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.257

(partial model without unconserved sides chains): PDB file : Tito_4F7O.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4F7O-query.scw PDB file : Tito_Scwrl_4F7O.pdb: