Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSTTSSATTPIEINALGQPCPMPLLMLKRELKKLSGKQLFLLKSSDPHSEIDVTRYCQLHHFTCQTMQISEREFHYLIETQ 3LVJ Chain:C ((5-81)) ----LFSSPDHTLDALGLRCPEPVMMVRKTVRNMQPGETLLIIADDPATTRDIPGFCTFMEHELVAKETDGLPYRYLIRKG

General information: TITO was launched using: RESULT: Template: 3LVJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 333 -41329 -124.11 -536.73 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain C : 0.71 3D Compatibility (PKB) : -124.11 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.529

(partial model without unconserved sides chains): PDB file : Tito_3LVJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3LVJ-query.scw PDB file : Tito_Scwrl_3LVJ.pdb: