Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNYYQHHIGDFNNATRHLSLIERAIYRDLLDMYYDTEKAIDASSIDRLARRLQCTTEEQKEALKYVLDEFFILEEGVYRNNRCEREIAEYHGKKKQASEAGKASAAKRAAKKKGSSNSGSSKDDQSSNENLTVVENPLNEEQTGVQPTNNHKPRTKNQEPRTNY 4J0U Chain:A ((341-386)) -------------------------YTDLANMYAEGGQYSNAEDIFRKALRLENITDDHKHQIHYHYGRF----------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4J0U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 115 -16234 -141.17 -360.76 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -141.17 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.430

(partial model without unconserved sides chains): PDB file : Tito_4J0U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4J0U-query.scw PDB file : Tito_Scwrl_4J0U.pdb: