Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFQGYSKDRREETCSYCGAIYIVDIPGLPGHEEREEYFCPECSHVNFARASNSPRVSLVKARTDGKNDKSPSFQALIDSYKDE 5IY9 Chain:L ((13-57)) -------QPMIYICGECHTENEIKS-------R-DPIRCRECGYRIMYKK-RTKRLVVFDA----------------------

General information: TITO was launched using: RESULT: Template: 5IY9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 111 -11296 -101.77 -251.02 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain L : 0.63 3D Compatibility (PKB) : -101.77 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.450

(partial model without unconserved sides chains): PDB file : Tito_5IY9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5IY9-query.scw PDB file : Tito_Scwrl_5IY9.pdb: