Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MANSAQAKKRARQNVKARKHNASLRSMVRTYIKRTLSAIAGGDYAVATEAYKKAVPVIDRMADKGIIHKNKAARHKSRLNAQVKALAN 1N34 Chain:T ((14-91)) --------KRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQL--

General information: TITO was launched using: RESULT: Template: 1N34.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain T - contact count / total energy / energy per contact / energy per residue : 229 -19605 -85.61 -251.34 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain T : 0.78 3D Compatibility (PKB) : -85.61 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.763

(partial model without unconserved sides chains): PDB file : Tito_1N34.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1N34-query.scw PDB file : Tito_Scwrl_1N34.pdb: