Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MWYFAWILGILMACFAGVLSALYIEHHQNLDEE 5VRE Chain:D ((57-86)) ---------LAFLTSFASILVMWVNHHRIF---

General information: TITO was launched using: RESULT: Template: 5VRE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 2 -615 -307.25 -29.26 target 2D structure prediction score : 0.95 Monomeric hydrophicity matching model chain D : 0.62 3D Compatibility (PKB) : -307.25 2D Compatibility (Sec. Struct. Predict.) : 0.95 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.159

(partial model without unconserved sides chains): PDB file : Tito_5VRE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5VRE-query.scw PDB file : Tito_Scwrl_5VRE.pdb: