Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNDKELTFKEGHDILKQNAELLESQESPDIDNLMKIVEESIGAYKACKSRIEAVQQALDETFKE 1VP7 Chain:C ((14-74)) -RPLPQDFETALAELESLVSAMENG-TLPLEQSLSAYRRGVELARVCQDRLAQAEQQVKVLEG-

General information: TITO was launched using: RESULT: Template: 1VP7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 107 -6159 -57.56 -100.96 target 2D structure prediction score : 0.93 Monomeric hydrophicity matching model chain C : 0.66 3D Compatibility (PKB) : -57.56 2D Compatibility (Sec. Struct. Predict.) : 0.93 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.574

(partial model without unconserved sides chains): PDB file : Tito_1VP7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1VP7-query.scw PDB file : Tito_Scwrl_1VP7.pdb: