Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDSNMEVLIKTEDAIDAYNGAANLARSLGVSRAAISQWGEYVPEVSARGLVILQPSIPHIIKKPSAT 3JXD Chain:L ((21-56)) ---------------------AALGKMVGVSNVAISQWERSETEPNGENLLALSKAL----------

General information: TITO was launched using: RESULT: Template: 3JXD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 98 -14739 -150.40 -409.42 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain L : 0.69 3D Compatibility (PKB) : -150.40 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.661

(partial model without unconserved sides chains): PDB file : Tito_3JXD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3JXD-query.scw PDB file : Tito_Scwrl_3JXD.pdb: