Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLRILKSILFEFEELMSQQSVEKKSVPWLLMGLGLLIPFLIIGILFLAAKSDAQNKKQYEQQRLEMEKRIAEKEAANSDKK 1Y04 Chain:A ((1-35)) ----------------------------------------------GSMNAPARAAAKTAADALAAAKKTAADAAAAAAAA

General information: TITO was launched using: RESULT: Template: 1Y04.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 17 2489 146.38 71.10 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.49 3D Compatibility (PKB) : 146.38 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.49 QMean score : 0.915

(partial model without unconserved sides chains): PDB file : Tito_1Y04.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Y04-query.scw PDB file : Tito_Scwrl_1Y04.pdb: