Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------MLLLLFLNHHSIAKTNLFVNVFHTVCLPFLKMIRLADFLAVIPASLLY 2EWT Chain:A ((1-71)) MSSEYAKQLGAKLRAIRTQQGLSLHGVEEKSQGRWKAVVVGSYERGDRAVTVQRLAELADFYGVPVQELLP

General information: TITO was launched using: RESULT: Template: 2EWT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 117 -10370 -88.63 -216.03 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -88.63 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.410

(partial model without unconserved sides chains): PDB file : Tito_2EWT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2EWT-query.scw PDB file : Tito_Scwrl_2EWT.pdb: