Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKRKKQVIPMYVVKVMHGYIDKTGCRTREKNLDNLLIFKDKKESEAFAKRIGGRVKPIQEVRPD 1RRP Chain:D ((112-132)) ----------------------------------AIRFKTPEEAALFKCKFEEAQ---------

General information: TITO was launched using: RESULT: Template: 1RRP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 18 -2462 -136.78 -117.24 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain D : 0.61 3D Compatibility (PKB) : -136.78 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 1.056

(partial model without unconserved sides chains): PDB file : Tito_1RRP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1RRP-query.scw PDB file : Tito_Scwrl_1RRP.pdb: