Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------------MLVFPAKYHLFKKKILEYMF----GKLYLKNHPLQKKDMIPLF--- 1G25 Chain:A ((1-65)) MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFED

General information: TITO was launched using: RESULT: Template: 1G25.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 145 3165 21.83 81.15 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 21.83 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.575

(partial model without unconserved sides chains): PDB file : Tito_1G25.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1G25-query.scw PDB file : Tito_Scwrl_1G25.pdb: