Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEHGTVKWFNNEKGFGFITVDGGDDVFVHFSAIQGDGFKSLEEGQEVEFTIVEGARGPQAAEVTKL 2LXJ Chain:A ((1-65)) MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQK-

General information: TITO was launched using: RESULT: Template: 2LXJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 268 -26538 -99.02 -408.28 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain A : 0.89 3D Compatibility (PKB) : -99.02 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.89 QMean score : 0.553

(partial model without unconserved sides chains): PDB file : Tito_2LXJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LXJ-query.scw PDB file : Tito_Scwrl_2LXJ.pdb: