Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSFSNGAISESTSEMEKASRMSEINFGVSLVFWGKQEIS 1N6J Chain:G ((4-29)) --SPKGSISEETKQKLKSAILSAQSAAN-----------

General information: TITO was launched using: RESULT: Template: 1N6J.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 29 1841 63.48 70.81 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain G : 0.59 3D Compatibility (PKB) : 63.48 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.455

(partial model without unconserved sides chains): PDB file : Tito_1N6J.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1N6J-query.scw PDB file : Tito_Scwrl_1N6J.pdb: