Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPNNRILLVFSITIKGAVFLIKELFNLNKRKDSIA------------KAIKLFLTRKTLIKQRNVLNLMTACLMGVLAII-- 1W8X Chain:P ((1-116)) MDKKKL---LYWVGGGLVLILIWLWFRNRPAAQVASNWEGPPYMTYNQPQAGSVTLPVADSITSQLNDYASSLNDYLASQAG

General information: TITO was launched using: RESULT: Template: 1W8X.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 36 -1291 -35.85 -19.85 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain P : 0.60 3D Compatibility (PKB) : -35.85 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.196

(partial model without unconserved sides chains): PDB file : Tito_1W8X.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1W8X-query.scw PDB file : Tito_Scwrl_1W8X.pdb: