Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLYLQKGRLFPGLEELLTYY 3N7Y Chain:B ((6-81)) WFFGKIPRAKAEEML-SKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVK-FNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 3N7Y.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 270 -42671 -158.04 -561.45 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain B : 0.81 3D Compatibility (PKB) : -158.04 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.709

(partial model without unconserved sides chains): PDB file : Tito_3N7Y.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3N7Y-query.scw PDB file : Tito_Scwrl_3N7Y.pdb: