Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKTVGNDLVRNQLHADRKWYLILGFVLIIFGLVLFSSLPFATFSVVFLFGILMMVGGVLHLIAALSVFKGGSRWLWALFGVLYLMAGYYAFSTPVTTAVVLTSLLSIALIIAGVIRTINAFLLRPIAGWGWTLFSGLLTLATGILILVSKDSPFWVLGMFLAVDILFQGINFLGLASAIKHLPSSSKTVS 4XE5 Chain:G ((24-39)) -----------------------------------------------IFAALAFIVGLVIILS-------------------------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4XE5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 1 -542 -542.00 -33.88 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain G : 0.36 3D Compatibility (PKB) : -542.00 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.36 QMean score : 0.254

(partial model without unconserved sides chains): PDB file : Tito_4XE5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4XE5-query.scw PDB file : Tito_Scwrl_4XE5.pdb: