Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKSFAINMAPTNHGGMIPATQSRTSQEGNLFVRAGDGHMCPKCKCWSVVIKSHDHVIMDGKPVAYVGDKLSCGATIMPQQFHVVGDSGSPYSSAAPVQNSLVEDKSNEIHKVQFKLVDVDTDQPLSAMLYEIHSKES--G--KLLVQGYTDKNGMTAIYESEHTPESVQLITIDLSKPLDPL 3IWV Chain:A ((13-55)) --------------------------------------------------------------------------------------------------------------------VLNIAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPG------------------------

General information: TITO was launched using: RESULT: Template: 3IWV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 75 1229 16.38 31.50 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : 16.38 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.384

(partial model without unconserved sides chains): PDB file : Tito_3IWV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IWV-query.scw PDB file : Tito_Scwrl_3IWV.pdb: