Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKIDNDSPSPSPEQYKPIGLIICYLLLGLPASLTIGSLIAQVLTINVSDFEGGRGYAWVWILMIISSLTYLACLIALPIVIKKYVNALSTVVIVFGILSIFSLSFLASL 2N9C Chain:A ((1-20)) ----------------------------------------MTEYKLVVVGAGGVGKSHVW-------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2N9C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 39 -5110 -131.01 -255.48 target 2D structure prediction score : 0.40 Monomeric hydrophicity matching model chain A : 0.33 3D Compatibility (PKB) : -131.01 2D Compatibility (Sec. Struct. Predict.) : 0.40 1D Compatibility (Hydrophobicity) : 0.33 QMean score : 0.336

(partial model without unconserved sides chains): PDB file : Tito_2N9C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2N9C-query.scw PDB file : Tito_Scwrl_2N9C.pdb: