Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKMTRILCHWYLEYLENALIYMNKANNPFGKKALKKPDLVDQASIFITGAMNENKFST 4X8W Chain:H ((1-48)) AAAAA----------AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

General information: TITO was launched using: RESULT: Template: 4X8W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 114 4563 40.03 95.06 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain H : 0.58 3D Compatibility (PKB) : 40.03 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.056

(partial model without unconserved sides chains): PDB file : Tito_4X8W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4X8W-query.scw PDB file : Tito_Scwrl_4X8W.pdb: