Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIQRISHHDLEHVYATAVNTIQSQMNFQDAVAQLEEVARAGHGKAALFLAELYYQGFRVERDSMKAQYWQKLATMQA 4BWR Chain:A ((33-82)) -----------------------TKDLTQAMDWFRRAAEQGYTPAEYVLGLRYMNGEGVPQDYAQAVIWYKKA----

General information: TITO was launched using: RESULT: Template: 4BWR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 138 -12778 -92.59 -255.56 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -92.59 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.754

(partial model without unconserved sides chains): PDB file : Tito_4BWR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4BWR-query.scw PDB file : Tito_Scwrl_4BWR.pdb: