Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence QVFGCFVQMSVRTQDSKDETNISSGGYLLTTNPGQLVFTDGNNNITVKVDKDCQSAGISYHRSEVHFTALQKLSENGGPFEFDQPLIELQ 5V6H Chain:E ((49-65)) ----------------------------------------------------------------------VALDETLGDFAFPDEFL---

General information: TITO was launched using: RESULT: Template: 5V6H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 16 -6160 -384.97 -362.32 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain E : 0.56 3D Compatibility (PKB) : -384.97 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.743

(partial model without unconserved sides chains): PDB file : Tito_5V6H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5V6H-query.scw PDB file : Tito_Scwrl_5V6H.pdb: