Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence RCNIAIQKNNILQSPEQQTAGNWFSFFVGVKPN---RILVAQCRSRSYHNCNNIECRKLAKGYSAGYVSLVGESGAVGSLGRDPQA 4K30 Chain:X ((120-147)) ------------------SNKQWIFFWFGLADIRDSYELVNHAKGL----------------------------------------

General information: TITO was launched using: RESULT: Template: 4K30.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 26 -4955 -190.56 -198.18 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain X : 0.62 3D Compatibility (PKB) : -190.56 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.230

(partial model without unconserved sides chains): PDB file : Tito_4K30.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4K30-query.scw PDB file : Tito_Scwrl_4K30.pdb: