Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KCNISILKDGKYFTQKQEIAGWTVKFHDLDGNYVGKCKNAHTYACTYVTCEDLAPGYSPGKSKDVVASGNVGSLGHD 3NGB Chain:D ((120-151)) ---------------------------------TGPCKNVSSVQCTH--------GIKPVVSTQLLLNGS-------

General information: TITO was launched using: RESULT: Template: 3NGB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 16 237 14.81 8.17 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain D : 0.61 3D Compatibility (PKB) : 14.81 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.289

(partial model without unconserved sides chains): PDB file : Tito_3NGB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3NGB-query.scw PDB file : Tito_Scwrl_3NGB.pdb: