Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVGCDGKVEHYRIMYHA-SKLSIDEEVYFENLMQLVEHY 3K2M Chain:A ((7-82)) WYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHH

General information: TITO was launched using: RESULT: Template: 3K2M.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 261 -25586 -98.03 -341.14 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.79 3D Compatibility (PKB) : -98.03 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.696

(partial model without unconserved sides chains): PDB file : Tito_3K2M.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3K2M-query.scw PDB file : Tito_Scwrl_3K2M.pdb: