Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGAIPRAEVAELLV---HSGDFLVRESQGK-QEYVLSVLWDGLPRHF-IIQSLDNLYRLEGEGFPSIPLLIDHL 1JYR Chain:A ((5-79)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDY-

General information: TITO was launched using: RESULT: Template: 1JYR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 230 8008 34.82 114.40 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : 34.82 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.546

(partial model without unconserved sides chains): PDB file : Tito_1JYR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1JYR-query.scw PDB file : Tito_Scwrl_1JYR.pdb: