Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY
1FU5 Chain:A ((13-88))WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDPLTFNSVVELINHY


General information:
TITO was launched using:
RESULT:

Template: 1FU5.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 260 -18696 -71.91 -245.99
target 2D structure prediction score : 0.76
Monomeric hydrophicity matching model chain A : 0.99

3D Compatibility (PKB) : -71.91
2D Compatibility (Sec. Struct. Predict.) : 0.76
1D Compatibility (Hydrophobicity) : 0.99
QMean score : 0.399

(partial model without unconserved sides chains):
PDB file : Tito_1FU5.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1FU5-query.scw
PDB file : Tito_Scwrl_1FU5.pdb: