Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -MGVVGKQSSSFSLLFWLFSLSSGKVTCFKSGSLGNSSNILPKLSHFVNFTAIGVPRF- 1L2W Chain:I ((22-78)) SVGEMSGRSVSQQTSDQYANNLAGRTESPQGSSL--ASRIIERLSSVAHSVIGFIQRMF

General information: TITO was launched using: RESULT: Template: 1L2W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 27 -14 -0.52 -0.25 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain I : 0.71 3D Compatibility (PKB) : -0.52 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.093

(partial model without unconserved sides chains): PDB file : Tito_1L2W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1L2W-query.scw PDB file : Tito_Scwrl_1L2W.pdb: