Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSDAFTDVAKMKKIKEEIKAHEGQVVEMTLENGRKRQKNRLGKLIEVYPSLFIVEFGDVEGDKQVNVYVESFTYSDILTEKNLIHYLD 1D3B Chain:E ((6-38)) -------------PIKVLHEAEGHIVTCETNTGE----VYRGKLIEAEDN--------------------------------------

General information: TITO was launched using: RESULT: Template: 1D3B.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 52 -1079 -20.75 -32.70 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain E : 0.56 3D Compatibility (PKB) : -20.75 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.650

(partial model without unconserved sides chains): PDB file : Tito_1D3B.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1D3B-query.scw PDB file : Tito_Scwrl_1D3B.pdb: