Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKNEINYLTMAMSLIALAMSFLTFQCNLLIVGMCYGAALVLIIIYIILKINRKTRNKDSNKC 5EGN Chain:H ((86-102)) --------------------------RAVFVGNSIGGMIAMQL-------------------

General information: TITO was launched using: RESULT: Template: 5EGN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 19 -4843 -254.89 -284.88 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain H : 0.55 3D Compatibility (PKB) : -254.89 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.890

(partial model without unconserved sides chains): PDB file : Tito_5EGN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EGN-query.scw PDB file : Tito_Scwrl_5EGN.pdb: