Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSLQRG-IYQHYKGNLYQVFSVAKHSETEEELVVYQCLYGDYSTWVRPLDMFTETVQMSDGSIVPRFKLIQST 2OER Chain:B ((54-66)) --VSIGSLYQYFPNK----------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2OER.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 6 -937 -156.17 -78.08 target 2D structure prediction score : 0.25 Monomeric hydrophicity matching model chain B : 0.48 3D Compatibility (PKB) : -156.17 2D Compatibility (Sec. Struct. Predict.) : 0.25 1D Compatibility (Hydrophobicity) : 0.48 QMean score : 0.552

(partial model without unconserved sides chains): PDB file : Tito_2OER.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2OER-query.scw PDB file : Tito_Scwrl_2OER.pdb: