Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFVALSFDWVFFFGVNMDTIEAKKNLNALCNEIEKLQNLSRSLMTAKEMLDIDAKIKRHKEQVKNIRSNLHA 1G6U Chain:B ((6-44)) --------------------------------KSELQALKKEGFSPEELAALESELQALEKKLAALKSKLQ-

General information: TITO was launched using: RESULT: Template: 1G6U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 37 -5762 -155.73 -147.74 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain B : 0.64 3D Compatibility (PKB) : -155.73 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.742

(partial model without unconserved sides chains): PDB file : Tito_1G6U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1G6U-query.scw PDB file : Tito_Scwrl_1G6U.pdb: