Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVNHQIKVLQALASAIAEGGRGVTGTAFPKQPVRALKLYEFEGSPFCRRIREVITLLNLDGLCCTNLLKADFTKSYQIQGTTRV 1S3D Chain:A ((1-35)) ----------------------------------NITIYHNPACGTSRNTLEMIRNSGTEPTII-LYLEN--------------

General information: TITO was launched using: RESULT: Template: 1S3D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 75 -12698 -169.31 -362.80 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -169.31 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.519

(partial model without unconserved sides chains): PDB file : Tito_1S3D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1S3D-query.scw PDB file : Tito_Scwrl_1S3D.pdb: