Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MWYFAWILGILMACFAGVLSALYIEHHQNLDEE 3S33 Chain:C ((12-23)) ------------LVLTLTILVFWL---------

General information: TITO was launched using: RESULT: Template: 3S33.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 1 -483 -483.00 -40.25 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain C : 0.55 3D Compatibility (PKB) : -483.00 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.805

(partial model without unconserved sides chains): PDB file : Tito_3S33.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3S33-query.scw PDB file : Tito_Scwrl_3S33.pdb: