Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---MAQVQDPTFWGGNIAFWIQTLVFFIS--ALIAIYTLRRNEAQAKK-RATVDLVLSETQDMYFRDIKEKFG-KYK----- 3L9A Chain:X ((9-88)) RDFFVITNSEYTFAG--VHYAKGAVLHVSPTQKRAFWVIADQENFIKQVNKNIEYVEKNASPAFLQRIVEIYQVKFEGKNVH

General information: TITO was launched using: RESULT: Template: 3L9A.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 241 10905 45.25 160.36 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain X : 0.68 3D Compatibility (PKB) : 45.25 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.103

(partial model without unconserved sides chains): PDB file : Tito_3L9A.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3L9A-query.scw PDB file : Tito_Scwrl_3L9A.pdb: