Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSAVNFNMRLEAELKEQVTPILEDYGLTMPQAFKLFLNQIVKTKAIPLSFDYARETALTPKAAAKLLQSLKEIENGEYTEYETVEEAIKAMSEEAHG 4HEA Chain:H ((190-251)) ----------------------KEHGWLFLYAFPAFLVYLIASMA---------EAARTP---FDLPEAEQELVGGYHTEYSSIKWALFQMAEYIH-

General information: TITO was launched using: RESULT: Template: 4HEA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output QMean score : ?

(partial model without unconserved sides chains): PDB file : Tito_4HEA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4HEA-query.scw PDB file : Tito_Scwrl_4HEA.pdb: