Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLLLLFLNHHSIAK------TNLFVNVFHTVCLPFLK----MIRLADFLAVIPASLLY 2DZN Chain:B ((360-416)) MSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVK-

General information: TITO was launched using: RESULT: Template: 2DZN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 102 -13856 -135.84 -294.81 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain B : 0.68 3D Compatibility (PKB) : -135.84 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.300

(partial model without unconserved sides chains): PDB file : Tito_2DZN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2DZN-query.scw PDB file : Tito_Scwrl_2DZN.pdb: