Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKRKKQVIPMYVVKVMHGYIDKTGCRTREKNLDNLLIFKDKKESEAFAKRIGGRVKPIQEVRPD 4HAX Chain:B ((113-137)) ---------------------------------FAIRFGSKENADKFKEEFEKAQEIN------

General information: TITO was launched using: RESULT: Template: 4HAX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 13 -1433 -110.23 -57.32 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : -110.23 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.772

(partial model without unconserved sides chains): PDB file : Tito_4HAX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4HAX-query.scw PDB file : Tito_Scwrl_4HAX.pdb: