Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGYDKHQARTSGWRVPENNLIFVSLLGGGLGGLISRKVFHHKTRKKKFTIGFAAGVLVDLILIYFFH 4KDQ Chain:D ((12-31)) --------------------------GGWQGMVDGWYGYHHSNEQG---------------------

General information: TITO was launched using: RESULT: Template: 4KDQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 10 -884 -88.40 -44.20 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain D : 0.46 3D Compatibility (PKB) : -88.40 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.46 QMean score : 0.319

(partial model without unconserved sides chains): PDB file : Tito_4KDQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4KDQ-query.scw PDB file : Tito_Scwrl_4KDQ.pdb: